Brand: | Abnova |
Reference: | H00003992-M04 |
Product name: | FADS1 monoclonal antibody (M04), clone 2D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FADS1. |
Clone: | 2D9 |
Isotype: | IgG2a Kappa |
Gene id: | 3992 |
Gene name: | FADS1 |
Gene alias: | D5D|FADS6|FADSD5|FLJ38956|FLJ90273|LLCDL1|TU12 |
Gene description: | fatty acid desaturase 1 |
Genbank accession: | NM_013402 |
Immunogen: | FADS1 (NP_037534, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS |
Protein accession: | NP_037534 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | monoclonal antibody (M04), clone 2D9. Western Blot analysis of expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |