Brand: | Abnova |
Reference: | H00003984-M05 |
Product name: | LIMK1 monoclonal antibody (M05), clone 2E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LIMK1. |
Clone: | 2E9 |
Isotype: | IgG2a Kappa |
Gene id: | 3984 |
Gene name: | LIMK1 |
Gene alias: | LIMK |
Gene description: | LIM domain kinase 1 |
Genbank accession: | NM_002314 |
Immunogen: | LIMK1 (NP_002305, 548 a.a. ~ 647 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD |
Protein accession: | NP_002305 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LIMK1 monoclonal antibody (M05), clone 2E9 Western Blot analysis of LIMK1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |