LIMK1 monoclonal antibody (M02A), clone 1B2 View larger

LIMK1 monoclonal antibody (M02A), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LIMK1 monoclonal antibody (M02A), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about LIMK1 monoclonal antibody (M02A), clone 1B2

Brand: Abnova
Reference: H00003984-M02A
Product name: LIMK1 monoclonal antibody (M02A), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant LIMK1.
Clone: 1B2
Isotype: IgG1 Kappa
Gene id: 3984
Gene name: LIMK1
Gene alias: LIMK
Gene description: LIM domain kinase 1
Genbank accession: NM_002314
Immunogen: LIMK1 (NP_002305, 548 a.a. ~ 647 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Protein accession: NP_002305
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003984-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003984-M02A-1-25-1.jpg
Application image note: LIMK1 monoclonal antibody (M02A), clone 1B2 Western Blot analysis of LIMK1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LIMK1 monoclonal antibody (M02A), clone 1B2 now

Add to cart