LIMK1 monoclonal antibody (M01), clone 1A8 View larger

LIMK1 monoclonal antibody (M01), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LIMK1 monoclonal antibody (M01), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about LIMK1 monoclonal antibody (M01), clone 1A8

Brand: Abnova
Reference: H00003984-M01
Product name: LIMK1 monoclonal antibody (M01), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant LIMK1.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 3984
Gene name: LIMK1
Gene alias: LIMK
Gene description: LIM domain kinase 1
Genbank accession: NM_002314
Immunogen: LIMK1 (NP_002305, 548 a.a. ~ 647 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Protein accession: NP_002305
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003984-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00003984-M01-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LIMK1 monoclonal antibody (M01), clone 1A8 now

Add to cart