LHX1 monoclonal antibody (M06), clone 1C11 View larger

LHX1 monoclonal antibody (M06), clone 1C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX1 monoclonal antibody (M06), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LHX1 monoclonal antibody (M06), clone 1C11

Brand: Abnova
Reference: H00003975-M06
Product name: LHX1 monoclonal antibody (M06), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant LHX1.
Clone: 1C11
Isotype: IgG2a Kappa
Gene id: 3975
Gene name: LHX1
Gene alias: LIM-1|LIM1|MGC126723|MGC138141
Gene description: LIM homeobox 1
Genbank accession: NM_005568
Immunogen: LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Protein accession: NP_005559
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003975-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LHX1 monoclonal antibody (M06), clone 1C11 now

Add to cart