LHX1 monoclonal antibody (M04), clone 2G5 View larger

LHX1 monoclonal antibody (M04), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX1 monoclonal antibody (M04), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about LHX1 monoclonal antibody (M04), clone 2G5

Brand: Abnova
Reference: H00003975-M04
Product name: LHX1 monoclonal antibody (M04), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant LHX1.
Clone: 2G5
Isotype: IgG2a Kappa
Gene id: 3975
Gene name: LHX1
Gene alias: LIM-1|LIM1|MGC126723|MGC138141
Gene description: LIM homeobox 1
Genbank accession: NM_005568
Immunogen: LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Protein accession: NP_005559
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003975-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy LHX1 monoclonal antibody (M04), clone 2G5 now

Add to cart