Brand: | Abnova |
Reference: | H00003963-M01 |
Product name: | LGALS7 monoclonal antibody (M01), clone 6B5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant LGALS7. |
Clone: | 6B5 |
Isotype: | IgG2a Kappa |
Gene id: | 3963 |
Gene name: | LGALS7 |
Gene alias: | GAL7|LGALS7A |
Gene description: | lectin, galactoside-binding, soluble, 7 |
Genbank accession: | NM_002307.1 |
Immunogen: | LGALS7 (NP_002298.1, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
Protein accession: | NP_002298.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LGALS7 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |