Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LGALS3 monoclonal antibody (M03), clone 3G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about LGALS3 monoclonal antibody (M03), clone 3G8
| Brand: | Abnova |
| Reference: | H00003958-M03 |
| Product name: | LGALS3 monoclonal antibody (M03), clone 3G8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant LGALS3. |
| Clone: | 3G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3958 |
| Gene name: | LGALS3 |
| Gene alias: | CBP35|GAL3|GALBP|GALIG|LGALS2|MAC2 |
| Gene description: | lectin, galactoside-binding, soluble, 3 |
| Genbank accession: | BC001120 |
| Immunogen: | LGALS3 (AAH01120, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Protein accession: | AAH01120 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LGALS3 monoclonal antibody (M03), clone 3G8. Western Blot analysis of LGALS3 expression in Hela S3 NE. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |