Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LGALS3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about LGALS3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003958-D01P |
| Product name: | LGALS3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LGALS3 protein. |
| Gene id: | 3958 |
| Gene name: | LGALS3 |
| Gene alias: | CBP35|GAL3|GALBP|GALIG|LGALS2|MAC2 |
| Gene description: | lectin, galactoside-binding, soluble, 3 |
| Genbank accession: | NM_002306.1 |
| Immunogen: | LGALS3 (AAH53667.1, 1 a.a. ~ 250 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Protein accession: | AAH53667.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of LGALS3 expression in transfected 293T cell line (H00003958-T01) by LGALS3 MaxPab polyclonal antibody. Lane 1: LGALS3 transfected lysate(26.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A crucial role of anti-RPLP0 and anti-galectin-3 antibodies in the development of skin lesions in systemic lupus erythematosus.Shi ZR, Tan GZ, Meng Z, Yu M, Li KW, Yin J, Wei KH, Luo YJ, Jia SQ, Zhang SJ, Wu J, Mi XB, Wang L Arthritis Rheumatol. 2014 Oct 10. doi: 10.1002/art.38891. |