LFNG monoclonal antibody (M19), clone 3D7 View larger

LFNG monoclonal antibody (M19), clone 3D7

H00003955-M19_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LFNG monoclonal antibody (M19), clone 3D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about LFNG monoclonal antibody (M19), clone 3D7

Brand: Abnova
Reference: H00003955-M19
Product name: LFNG monoclonal antibody (M19), clone 3D7
Product description: Mouse monoclonal antibody raised against a full length recombinant LFNG.
Clone: 3D7
Isotype: IgG2b Kappa
Gene id: 3955
Gene name: LFNG
Gene alias: SCDO3
Gene description: LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Genbank accession: NM_002304
Immunogen: LFNG (NP_002295, 1 a.a. ~ 125 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFAT*
Protein accession: NP_002295
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy LFNG monoclonal antibody (M19), clone 3D7 now

Add to cart