Brand: | Abnova |
Reference: | H00003955-M11 |
Product name: | LFNG monoclonal antibody (M11), clone 1B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LFNG. |
Clone: | 1B6 |
Isotype: | IgG2a Kappa |
Gene id: | 3955 |
Gene name: | LFNG |
Gene alias: | SCDO3 |
Gene description: | LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
Genbank accession: | NM_002304 |
Immunogen: | LFNG (NP_002295, 1 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFAT* |
Protein accession: | NP_002295 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LFNG monoclonal antibody (M11), clone 1B6. Western Blot analysis of LFNG expression in human pancreas. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |