Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LETM1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LETM1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003954-A01 |
| Product name: | LETM1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LETM1. |
| Gene id: | 3954 |
| Gene name: | LETM1 |
| Gene alias: | - |
| Gene description: | leucine zipper-EF-hand containing transmembrane protein 1 |
| Genbank accession: | NM_012318 |
| Immunogen: | LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA |
| Protein accession: | NP_036450 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MCUR1 is an essential component of mitochondrial Ca(2+) uptake that regulates cellular metabolism.Mallilankaraman K, Cardenas C, Doonan PJ, Chandramoorthy HC, Irrinki KM, Golenar T, Csordas G, Madireddi P, Yang J, Muller M, Miller R, Kolesar JE, Molgo J, Kaufman B, Hajnoczky G, Foskett JK, Madesh M. Nat Cell Biol. 2012 Dec;14(12):1336-43. doi: 10.1038/ncb2622. Epub 2012 Nov 25. |