LEP monoclonal antibody (M02), clone M1 View larger

LEP monoclonal antibody (M02), clone M1

H00003952-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEP monoclonal antibody (M02), clone M1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about LEP monoclonal antibody (M02), clone M1

Brand: Abnova
Reference: H00003952-M02
Product name: LEP monoclonal antibody (M02), clone M1
Product description: Mouse monoclonal antibody raised against a full length recombinant LEP.
Clone: M1
Isotype: IgG1 Kappa
Gene id: 3952
Gene name: LEP
Gene alias: FLJ94114|OB|OBS
Gene description: leptin
Genbank accession: BC060830
Immunogen: LEP (AAH60830.1, 22 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Protein accession: AAH60830.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003952-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged LEP is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy LEP monoclonal antibody (M02), clone M1 now

Add to cart