Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LDLR polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LDLR polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003949-A01 |
| Product name: | LDLR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LDLR. |
| Gene id: | 3949 |
| Gene name: | LDLR |
| Gene alias: | FH|FHC |
| Gene description: | low density lipoprotein receptor |
| Genbank accession: | NM_000527 |
| Immunogen: | LDLR (NP_000518, 105 a.a. ~ 205 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL |
| Protein accession: | NP_000518 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Type 2 Diabetes Biomarkers and Uses Thereof.Paramithiotis E, Prentki M, Rabasa-lhoret R, Croteau P, Lanoix J, Madiraju MSR, Joly E. United States Patent Application. 2015 Nov. 20150330997A1 |