LDHC purified MaxPab mouse polyclonal antibody (B01P) View larger

LDHC purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LDHC purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LDHC purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003948-B01P
Product name: LDHC purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LDHC protein.
Gene id: 3948
Gene name: LDHC
Gene alias: CT32|LDH3|LDHX|MGC111073
Gene description: lactate dehydrogenase C
Genbank accession: NM_002301.2
Immunogen: LDHC (NP_002292.1, 1 a.a. ~ 332 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Protein accession: NP_002292.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003948-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LDHC expression in transfected 293T cell line (H00003948-T01) by LDHC MaxPab polyclonal antibody.

Lane 1: LDHC transfected lysate(36.52 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LDHC purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart