LDHA purified MaxPab rabbit polyclonal antibody (D01P) View larger

LDHA purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LDHA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about LDHA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003939-D01P
Product name: LDHA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human LDHA protein.
Gene id: 3939
Gene name: LDHA
Gene alias: LDH-M|LDH1|PIG19
Gene description: lactate dehydrogenase A
Genbank accession: NM_005566.1
Immunogen: LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Protein accession: NP_005557.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003939-D01P-2-A0-1.jpg
Application image note: LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LDHA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart