Brand: | Abnova |
Reference: | H00003939-D01P |
Product name: | LDHA purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human LDHA protein. |
Gene id: | 3939 |
Gene name: | LDHA |
Gene alias: | LDH-M|LDH1|PIG19 |
Gene description: | lactate dehydrogenase A |
Genbank accession: | NM_005566.1 |
Immunogen: | LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Protein accession: | NP_005557.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |