Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LDHA MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,IP |
More info about LDHA MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00003939-D01 |
| Product name: | LDHA MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LDHA protein. |
| Gene id: | 3939 |
| Gene name: | LDHA |
| Gene alias: | LDH-M|LDH1|PIG19 |
| Gene description: | lactate dehydrogenase A |
| Genbank accession: | NM_005566.1 |
| Immunogen: | LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
| Protein accession: | NP_005557.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney. |
| Applications: | WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | TOM70 Sustains Cell Bioenergetics by Promoting IP3R3-Mediated ER to Mitochondria Ca2+ Transfer.Filadi R, Leal NS, Schreiner B, Rossi A, Dentoni G, Pinho CM, Wiehager B, Cieri D, Cali T, Pizzo P, Ankarcrona M. Curr Biol. 2018 Feb 5;28(3):369-382.e6. doi: 10.1016/j.cub.2017.12.047. Epub 2018 Jan 27. |