LAMP2 monoclonal antibody (M01), clone 2G10 View larger

LAMP2 monoclonal antibody (M01), clone 2G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMP2 monoclonal antibody (M01), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about LAMP2 monoclonal antibody (M01), clone 2G10

Brand: Abnova
Reference: H00003920-M01
Product name: LAMP2 monoclonal antibody (M01), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant LAMP2.
Clone: 2G10
Isotype: IgG2a Kappa
Gene id: 3920
Gene name: LAMP2
Gene alias: CD107b|LAMPB|LGP110
Gene description: lysosomal-associated membrane protein 2
Genbank accession: NM_013995
Immunogen: LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Protein accession: NP_054701
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003920-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003920-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged LAMP2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAMP2 monoclonal antibody (M01), clone 2G10 now

Add to cart