Brand: | Abnova |
Reference: | H00003915-M01 |
Product name: | LAMC1 monoclonal antibody (M01), clone 2E6-B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LAMC1. |
Clone: | 2E6-B4 |
Isotype: | IgG2a kappa |
Gene id: | 3915 |
Gene name: | LAMC1 |
Gene alias: | LAMB2|MGC87297 |
Gene description: | laminin, gamma 1 (formerly LAMB2) |
Genbank accession: | BC015586 |
Immunogen: | LAMC1 (AAH15586, 1 a.a. ~ 38 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS |
Protein accession: | AAH15586 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LAMC1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |