LAMB3 monoclonal antibody (M01), clone 2G10 View larger

LAMB3 monoclonal antibody (M01), clone 2G10

H00003914-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMB3 monoclonal antibody (M01), clone 2G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about LAMB3 monoclonal antibody (M01), clone 2G10

Brand: Abnova
Reference: H00003914-M01
Product name: LAMB3 monoclonal antibody (M01), clone 2G10
Product description: Mouse monoclonal antibody raised against a partial recombinant LAMB3.
Clone: 2G10
Isotype: IgG1 Kappa
Gene id: 3914
Gene name: LAMB3
Gene alias: BM600-125KDA|FLJ99565|LAM5|LAMNB1
Gene description: laminin, beta 3
Genbank accession: NM_000228
Immunogen: LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
Protein accession: NP_000219
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003914-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003914-M01-1-4-1.jpg
Application image note: LAMB3 monoclonal antibody (M01), clone 2G10 Western Blot analysis of LAMB3 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma.Kita Y, Mimori K, Tanaka F, Matsumoto T, Haraguchi N, Ishikawa K, Matsuzaki S, Fukuyoshi Y, Inoue H, Natsugoe S, Aikou T, Mori M.
Eur J Surg Oncol. 2009 Jan;35(1):52-58. Epub 2008 Mar 10.

Reviews

Buy LAMB3 monoclonal antibody (M01), clone 2G10 now

Add to cart