Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LAMA4 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr,PLA-Ce |
More info about LAMA4 purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00003910-B03P |
| Product name: | LAMA4 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LAMA4 protein. |
| Gene id: | 3910 |
| Gene name: | LAMA4 |
| Gene alias: | DKFZp686D23145|LAMA3|LAMA4*-1 |
| Gene description: | laminin, alpha 4 |
| Genbank accession: | BC004241 |
| Immunogen: | LAMA4 (AAH04241, 1 a.a. ~ 120 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL |
| Protein accession: | AAH04241 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between TP53 and LAMA4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-LAMA4 mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |