H00003910-B02P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003910-B02P |
Product name: | LAMA4 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LAMA4 protein. |
Gene id: | 3910 |
Gene name: | LAMA4 |
Gene alias: | DKFZp686D23145|LAMA3|LAMA4*-1 |
Gene description: | laminin, alpha 4 |
Genbank accession: | BC004241.1 |
Immunogen: | LAMA4 (AAH04241.1, 1 a.a. ~ 120 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL |
Protein accession: | AAH04241.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LAMA4 expression in transfected 293T cell line (H00003910-T02) by LAMA4 MaxPab polyclonal antibody. Lane 1: LAMA4 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |