LAMA2 monoclonal antibody (M02), clone 1A7 View larger

LAMA2 monoclonal antibody (M02), clone 1A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMA2 monoclonal antibody (M02), clone 1A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LAMA2 monoclonal antibody (M02), clone 1A7

Brand: Abnova
Reference: H00003908-M02
Product name: LAMA2 monoclonal antibody (M02), clone 1A7
Product description: Mouse monoclonal antibody raised against a partial recombinant LAMA2.
Clone: 1A7
Isotype: IgG1 Kappa
Gene id: 3908
Gene name: LAMA2
Gene alias: LAMM
Gene description: laminin, alpha 2
Genbank accession: NM_000426
Immunogen: LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Protein accession: NP_000417
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003908-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LAMA2 monoclonal antibody (M02), clone 1A7 now

Add to cart