LAIR1 monoclonal antibody (M01), clone 2G4 View larger

LAIR1 monoclonal antibody (M01), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAIR1 monoclonal antibody (M01), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about LAIR1 monoclonal antibody (M01), clone 2G4

Brand: Abnova
Reference: H00003903-M01
Product name: LAIR1 monoclonal antibody (M01), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant LAIR1.
Clone: 2G4
Isotype: IgG2a Kappa
Gene id: 3903
Gene name: LAIR1
Gene alias: CD305|LAIR-1
Gene description: leukocyte-associated immunoglobulin-like receptor 1
Genbank accession: NM_002287
Immunogen: LAIR1 (NP_002278.1, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Protein accession: NP_002278.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003903-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003903-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged LAIR1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAIR1 monoclonal antibody (M01), clone 2G4 now

Add to cart