Brand: | Abnova |
Reference: | H00003897-M11 |
Product name: | L1CAM monoclonal antibody (M11), clone 3B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant L1CAM. |
Clone: | 3B10 |
Isotype: | IgG1 Kappa |
Gene id: | 3897 |
Gene name: | L1CAM |
Gene alias: | CAML1|CD171|HSAS|HSAS1|MASA|MIC5|N-CAML1|S10|SPG1 |
Gene description: | L1 cell adhesion molecule |
Genbank accession: | NM_000425 |
Immunogen: | L1CAM (NP_000416, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA |
Protein accession: | NP_000416 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged L1CAM is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |