Brand: | Abnova |
Reference: | H00003868-A01 |
Product name: | KRT16 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KRT16. |
Gene id: | 3868 |
Gene name: | KRT16 |
Gene alias: | CK16|K16|K1CP|KRT16A|NEPPK |
Gene description: | keratin 16 |
Genbank accession: | NM_005557 |
Immunogen: | KRT16 (NP_005548, 301 a.a. ~ 398 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ |
Protein accession: | NP_005548 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KRT16 polyclonal antibody (A01), Lot # 060118JC01 Western Blot analysis of KRT16 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |