Brand: | Abnova |
Reference: | H00003856-M02 |
Product name: | KRT8 monoclonal antibody (M02), clone 3E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KRT8. |
Clone: | 3E3 |
Isotype: | IgG2b Kappa |
Gene id: | 3856 |
Gene name: | KRT8 |
Gene alias: | CARD2|CK8|CYK8|K2C8|K8|KO |
Gene description: | keratin 8 |
Genbank accession: | NM_002273 |
Immunogen: | KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL |
Protein accession: | NP_002264 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003856-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003856-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003856-M02-9-19-1.jpg](http://www.abnova.com/application_image/H00003856-M02-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged KRT8 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |