KRT8 polyclonal antibody (A01) View larger

KRT8 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KRT8 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about KRT8 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003856-A01
Product name: KRT8 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant KRT8.
Gene id: 3856
Gene name: KRT8
Gene alias: CARD2|CK8|CYK8|K2C8|K8|KO
Gene description: keratin 8
Genbank accession: NM_002273
Immunogen: KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL
Protein accession: NP_002264
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003856-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003856-A01-2-A5-1.jpg
Application image note: KRT8 polyclonal antibody (A01), Lot # 050921JC01. Western Blot analysis of KRT8 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KRT8 polyclonal antibody (A01) now

Add to cart