Brand: | Abnova |
Reference: | H00003856-A01 |
Product name: | KRT8 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KRT8. |
Gene id: | 3856 |
Gene name: | KRT8 |
Gene alias: | CARD2|CK8|CYK8|K2C8|K8|KO |
Gene description: | keratin 8 |
Genbank accession: | NM_002273 |
Immunogen: | KRT8 (NP_002264, 91 a.a. ~ 195 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL |
Protein accession: | NP_002264 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KRT8 polyclonal antibody (A01), Lot # 050921JC01. Western Blot analysis of KRT8 expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |