KRAS monoclonal antibody (M02A), clone 4F3 View larger

KRAS monoclonal antibody (M02A), clone 4F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KRAS monoclonal antibody (M02A), clone 4F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about KRAS monoclonal antibody (M02A), clone 4F3

Brand: Abnova
Reference: H00003845-M02A
Product name: KRAS monoclonal antibody (M02A), clone 4F3
Product description: Mouse monoclonal antibody raised against a partial recombinant KRAS.
Clone: 4F3
Isotype: IgG2a Kappa
Gene id: 3845
Gene name: KRAS
Gene alias: C-K-RAS|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS3|RASK2
Gene description: v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Genbank accession: NM_004985
Immunogen: KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
Protein accession: NP_004976
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003845-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003845-M02A-1-1-1.jpg
Application image note: KRAS monoclonal antibody (M02A), clone 4F3 Western Blot analysis of KRAS expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KRAS monoclonal antibody (M02A), clone 4F3 now

Add to cart