Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RANBP5 monoclonal antibody (M01), clone 1C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RANBP5 monoclonal antibody (M01), clone 1C4
| Brand: | Abnova |
| Reference: | H00003843-M01 |
| Product name: | RANBP5 monoclonal antibody (M01), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RANBP5. |
| Clone: | 1C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3843 |
| Gene name: | IPO5 |
| Gene alias: | DKFZp686O1576|FLJ43041|IMB3|KPNB3|MGC2068|RANBP5 |
| Gene description: | importin 5 |
| Genbank accession: | BC001497 |
| Immunogen: | RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME |
| Protein accession: | AAH01497 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Localization of retinitis pigmentosa 2 to cilia is regulated by Importin {beta}2.Hurd TW, Fan S, Margolis BL. J Cell Sci. 2011 Mar 1;124(Pt 5):718-26. Epub 2011 Feb 1. |