KPNA2 polyclonal antibody (A01) View larger

KPNA2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KPNA2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about KPNA2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003838-A01
Product name: KPNA2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant KPNA2.
Gene id: 3838
Gene name: KPNA2
Gene alias: IPOA1|QIP2|RCH1|SRP1alpha
Gene description: karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
Genbank accession: NM_002266
Immunogen: KPNA2 (NP_002257, 420 a.a. ~ 528 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFN
Protein accession: NP_002257
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003838-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KPNA2 polyclonal antibody (A01) now

Add to cart