KPNA1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

H00003836-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003836-D01P
Product name: KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human KPNA1 protein.
Gene id: 3836
Gene name: KPNA1
Gene alias: IPOA5|NPI-1|RCH2|SRP1
Gene description: karyopherin alpha 1 (importin alpha 5)
Genbank accession: NM_002264
Immunogen: KPNA1 (NP_002255.2, 1 a.a. ~ 538 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Protein accession: NP_002255.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00003836-D01P-2-D6-1.jpg
Application image note: KPNA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KPNA1 expression in mouse intestine.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KPNA1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart