Brand: | Abnova |
Reference: | H00003836-A02 |
Product name: | KPNA1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant KPNA1. |
Gene id: | 3836 |
Gene name: | KPNA1 |
Gene alias: | IPOA5|NPI-1|RCH2|SRP1 |
Gene description: | karyopherin alpha 1 (importin alpha 5) |
Genbank accession: | BC002374 |
Immunogen: | KPNA1 (AAH02374.1, 1 a.a. ~ 538 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL |
Protein accession: | AAH02374.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (85.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | KPNA1 polyclonal antibody (A02), Lot # 061025JCS1 Western Blot analysis of KPNA1 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Nuclear localization of endogenous RGK proteins and modulation of cell shape remodeling by regulated nuclear transport.Mahalakshmi RN, Ng MY, Guo K, Qi Z, Hunziker W, Beguin P. Traffic. 2007 Sep;8(9):1164-78. Epub 2007 Jul 1. |