KLRC1 monoclonal antibody (M01), clone 2C3 View larger

KLRC1 monoclonal antibody (M01), clone 2C3

H00003821-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLRC1 monoclonal antibody (M01), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about KLRC1 monoclonal antibody (M01), clone 2C3

Brand: Abnova
Reference: H00003821-M01
Product name: KLRC1 monoclonal antibody (M01), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant KLRC1.
Clone: 2C3
Isotype: IgG1 Kappa
Gene id: 3821
Gene name: KLRC1
Gene alias: CD159A|MGC13374|MGC59791|NKG2|NKG2A
Gene description: killer cell lectin-like receptor subfamily C, member 1
Genbank accession: NM_213658
Immunogen: KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
Protein accession: NP_998823
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy KLRC1 monoclonal antibody (M01), clone 2C3 now

Add to cart