Brand: | Abnova |
Reference: | H00003821-A01 |
Product name: | KLRC1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KLRC1. |
Gene id: | 3821 |
Gene name: | KLRC1 |
Gene alias: | CD159A|MGC13374|MGC59791|NKG2|NKG2A |
Gene description: | killer cell lectin-like receptor subfamily C, member 1 |
Genbank accession: | NM_213658 |
Immunogen: | KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK |
Protein accession: | NP_998823 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KLRC1 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of KLRC1 expression in SJCRH30 ( Cat # L027V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |