Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,IP |
Brand: | Abnova |
Reference: | H00003817-D01 |
Product name: | KLK2 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human KLK2 protein. |
Gene id: | 3817 |
Gene name: | KLK2 |
Gene alias: | KLK2A2|MGC12201|hK2 |
Gene description: | kallikrein-related peptidase 2 |
Genbank accession: | NM_001002231.1 |
Immunogen: | KLK2 (NP_001002231.1, 1 a.a. ~ 223 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGVSHPYSQHLEGKG |
Protein accession: | NP_001002231.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of KLK2 expression in transfected 293T cell line (H00003817-T02) by KLK2 MaxPab polyclonal antibody. Lane 1: KLK2 transfected lysate(24.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |