KLK2 MaxPab mouse polyclonal antibody (B01) View larger

KLK2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about KLK2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003817-B01
Product name: KLK2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human KLK2 protein.
Gene id: 3817
Gene name: KLK2
Gene alias: KLK2A2|MGC12201|hK2
Gene description: kallikrein-related peptidase 2
Genbank accession: NM_001002231.1
Immunogen: KLK2 (NP_001002231.1, 1 a.a. ~ 223 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGVSHPYSQHLEGKG
Protein accession: NP_001002231.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003817-B01-13-15-1.jpg
Application image note: Western Blot analysis of KLK2 expression in transfected 293T cell line (H00003817-T01) by KLK2 MaxPab polyclonal antibody.

Lane 1: KLK2 transfected lysate(24.53 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLK2 MaxPab mouse polyclonal antibody (B01) now

Add to cart