Brand: | Abnova |
Reference: | H00003816-P01 |
Product name: | KLK1 (Human) Recombinant Protein (P01) |
Product description: | Human KLK1 full-length ORF ( NP_002248.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3816 |
Gene name: | KLK1 |
Gene alias: | KLKR|Klk6|hK1 |
Gene description: | kallikrein 1 |
Genbank accession: | NM_002257.2 |
Immunogen sequence/protein sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
Protein accession: | NP_002248.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00003816-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003816-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Neutrophil-Derived Proteinase 3 Induces Kallikrein-Independent Release of a Novel Vasoactive Kinin.Kahn R, Hellmark T, Leeb-Lundberg LM, Akbari N, Todiras M, Olofsson T, Wieslander J, Christensson A, Westman K, Bader M, Muller-Esterl W, Karpman D. J Immunol. 2009 Jun 15;182(12):7906-15. |