KLK1 monoclonal antibody (M02), clone 3D1 View larger

KLK1 monoclonal antibody (M02), clone 3D1

H00003816-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK1 monoclonal antibody (M02), clone 3D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about KLK1 monoclonal antibody (M02), clone 3D1

Brand: Abnova
Reference: H00003816-M02
Product name: KLK1 monoclonal antibody (M02), clone 3D1
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK1.
Clone: 3D1
Isotype: IgG2a Kappa
Gene id: 3816
Gene name: KLK1
Gene alias: KLKR|Klk6|hK1
Gene description: kallikrein 1
Genbank accession: BC005313
Immunogen: KLK1 (AAH05313, 168 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Protein accession: AAH05313
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003816-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KLK1 monoclonal antibody (M02), clone 3D1 now

Add to cart