KLK1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

KLK1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about KLK1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003816-D01P
Product name: KLK1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human KLK1 protein.
Gene id: 3816
Gene name: KLK1
Gene alias: KLKR|Klk6|hK1
Gene description: kallikrein 1
Genbank accession: NM_002257.2
Immunogen: KLK1 (NP_002248.1, 1 a.a. ~ 262 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Protein accession: NP_002248.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003816-D01P-2-A1-1.jpg
Application image note: KLK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLK1 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLK1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart