Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KIT monoclonal antibody (M11), clone 4F19
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about KIT monoclonal antibody (M11), clone 4F19
| Brand: | Abnova |
| Reference: | H00003815-M11 |
| Product name: | KIT monoclonal antibody (M11), clone 4F19 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KIT. |
| Clone: | 4F19 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3815 |
| Gene name: | KIT |
| Gene alias: | C-Kit|CD117|PBT|SCFR |
| Gene description: | v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog |
| Genbank accession: | NM_000222 |
| Immunogen: | KIT (NP_000213, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD |
| Protein accession: | NP_000213 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |