KIT monoclonal antibody (M03), clone 3A8 View larger

KIT monoclonal antibody (M03), clone 3A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIT monoclonal antibody (M03), clone 3A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about KIT monoclonal antibody (M03), clone 3A8

Brand: Abnova
Reference: H00003815-M03
Product name: KIT monoclonal antibody (M03), clone 3A8
Product description: Mouse monoclonal antibody raised against a partial recombinant KIT.
Clone: 3A8
Isotype: IgG1 Kappa
Gene id: 3815
Gene name: KIT
Gene alias: C-Kit|CD117|PBT|SCFR
Gene description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Genbank accession: NM_000222
Immunogen: KIT (NP_000213, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD
Protein accession: NP_000213
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003815-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003815-M03-13-15-1.jpg
Application image note: Western Blot analysis of KIT expression in transfected 293T cell line by KIT monoclonal antibody (M03), clone 3A8.

Lane 1: KIT transfected lysate(109.865 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KIT monoclonal antibody (M03), clone 3A8 now

Add to cart