KDR monoclonal antibody (M02), clone 4A2 View larger

KDR monoclonal antibody (M02), clone 4A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KDR monoclonal antibody (M02), clone 4A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about KDR monoclonal antibody (M02), clone 4A2

Brand: Abnova
Reference: H00003791-M02
Product name: KDR monoclonal antibody (M02), clone 4A2
Product description: Mouse monoclonal antibody raised against a partial recombinant KDR.
Clone: 4A2
Isotype: IgG2a Kappa
Gene id: 3791
Gene name: KDR
Gene alias: CD309|FLK1|VEGFR|VEGFR2
Gene description: kinase insert domain receptor (a type III receptor tyrosine kinase)
Genbank accession: NM_002253
Immunogen: KDR (NP_002244, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS
Protein accession: NP_002244
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003791-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003791-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged KDR is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KDR monoclonal antibody (M02), clone 4A2 now

Add to cart