Brand: | Abnova |
Reference: | H00003767-A01 |
Product name: | KCNJ11 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KCNJ11. |
Gene id: | 3767 |
Gene name: | KCNJ11 |
Gene alias: | BIR|HHF2|IKATP|KIR6.2|MGC133230|PHHI|TNDM3 |
Gene description: | potassium inwardly-rectifying channel, subfamily J, member 11 |
Genbank accession: | NM_000525 |
Immunogen: | KCNJ11 (NP_000516, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS |
Protein accession: | NP_000516 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KCNJ11 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of KCNJ11 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |