Brand: | Abnova |
Reference: | H00003753-M13 |
Product name: | KCNE1 monoclonal antibody (M13), clone 2A6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant KCNE1. |
Clone: | 2A6 |
Isotype: | IgG2a Kappa |
Gene id: | 3753 |
Gene name: | KCNE1 |
Gene alias: | FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK |
Gene description: | potassium voltage-gated channel, Isk-related family, member 1 |
Genbank accession: | BC036452 |
Immunogen: | KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS |
Protein accession: | AAH36452 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |