Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KCNE1 monoclonal antibody (M01), clone 5B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,RNAi-Ab |
More info about KCNE1 monoclonal antibody (M01), clone 5B12
| Brand: | Abnova |
| Reference: | H00003753-M01 |
| Product name: | KCNE1 monoclonal antibody (M01), clone 5B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KCNE1. |
| Clone: | 5B12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3753 |
| Gene name: | KCNE1 |
| Gene alias: | FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK |
| Gene description: | potassium voltage-gated channel, Isk-related family, member 1 |
| Genbank accession: | NM_000219 |
| Immunogen: | KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP |
| Protein accession: | NP_000210 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | [Ca2+]i Elevation and Oxidative Stress Induce KCNQ1 Protein Translocation from the Cytosol to the Cell Surface and Increase Slow Delayed Rectifier (IKs) in Cardiac Myocytes.Wang Y, Zankov DP, Jiang M, Zhang M, Henderson SC, Tseng GN J Biol Chem. 2013 Dec 6;288(49):35358-71. doi: 10.1074/jbc.M113.504746. Epub 2013 Oct 18. |