Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003753-D01 |
Product name: | KCNE1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human KCNE1 protein. |
Gene id: | 3753 |
Gene name: | KCNE1 |
Gene alias: | FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK |
Gene description: | potassium voltage-gated channel, Isk-related family, member 1 |
Genbank accession: | NM_000219.2 |
Immunogen: | KCNE1 (NP_000210.2, 1 a.a. ~ 129 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP |
Protein accession: | NP_000210.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of KCNE1 expression in transfected 293T cell line (H00003753-T01) by KCNE1 MaxPab polyclonal antibody. Lane 1: KCNE1 transfected lysate(14.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |