KCNE1 MaxPab mouse polyclonal antibody (B01) View larger

KCNE1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNE1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about KCNE1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003753-B01
Product name: KCNE1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human KCNE1 protein.
Gene id: 3753
Gene name: KCNE1
Gene alias: FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK
Gene description: potassium voltage-gated channel, Isk-related family, member 1
Genbank accession: NM_000219.2
Immunogen: KCNE1 (NP_000210.2, 1 a.a. ~ 129 a.a) full-length human protein.
Immunogen sequence/protein sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Protein accession: NP_000210.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003753-B01-13-15-1.jpg
Application image note: Western Blot analysis of KCNE1 expression in transfected 293T cell line (H00003753-T01) by KCNE1 MaxPab polyclonal antibody.

Lane 1: KCNE1 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KCNE1 MaxPab mouse polyclonal antibody (B01) now

Add to cart