Brand: | Abnova |
Reference: | H00003714-M10 |
Product name: | JAG2 monoclonal antibody (M10), clone 4G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant JAG2. |
Clone: | 4G10 |
Isotype: | IgG1 Kappa |
Gene id: | 3714 |
Gene name: | JAG2 |
Gene alias: | HJ2|SER2 |
Gene description: | jagged 2 |
Genbank accession: | NM_002226 |
Immunogen: | JAG2 (NP_002217, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSAPCNKF |
Protein accession: | NP_002217 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | JAG2 monoclonal antibody (M10), clone 4G10 Western Blot analysis of JAG2 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |