Brand: | Abnova |
Reference: | H00003714-A01 |
Product name: | JAG2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant JAG2. |
Gene id: | 3714 |
Gene name: | JAG2 |
Gene alias: | HJ2|SER2 |
Gene description: | jagged 2 |
Genbank accession: | NM_002226 |
Immunogen: | JAG2 (NP_002217, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSAPCNKF |
Protein accession: | NP_002217 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |